PDB entry 2q1x

View 2q1x on RCSB PDB site
Description: Crystal Structure of cell division protein FtsZ from Mycobacterium tuberculosis in complex with citrate.
Class: Cell Cycle, Signaling Protein
Keywords: FtsZ, Cell Division, Protein, tuberculosis, Cell Cycle, Signaling Protein
Deposited on 2007-05-25, released 2008-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.18
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q1xa1, d2q1xa2
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q1xb1, d2q1xb2
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q1xA (A:)
    mtpphnylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgr
    dstrglgagadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiark
    lgaltvgvvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdaf
    rsadevllngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslkaaei
    ainsplleasmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtviddslg
    devrvtviaagfdvsgpgrkpvmgetggahriesakagkltstlfepvdavsvplhtnga
    tlsiggddddvdvppfmrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q1xA (A:)
    lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdsadpev
    grkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfs
    fegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevllngvqgi
    tdlittpglinvdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmega
    qgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q1xB (B:)
    mtpphnylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgr
    dstrglgagadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiark
    lgaltvgvvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdaf
    rsadevllngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslkaaei
    ainsplleasmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtviddslg
    devrvtviaagfdvsgpgrkpvmgetggahriesakagkltstlfepvdavsvplhtnga
    tlsiggddddvdvppfmrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q1xB (B:)
    nylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgdpevgr
    kaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfsfe
    gkrqaengiaalrescdtlivipndrllvslmdafrsadevllngvqgitdlittpglin
    vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
    dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf