PDB entry 2q1t

View 2q1t on RCSB PDB site
Description: Crystal structure of the Bordetella bronchiseptica enzyme WbmF in complex with NAD+ and UDP
Class: Sugar Binding Protein
Keywords: ROSSMANN FOLD, PROTEIN-NAD+ COMPLEX, PROTEIN-UDP COMPLEX, Sugar Binding Protein
Deposited on 2007-05-25, released 2007-10-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative nucleotide sugar epimerase/ dehydratase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BbLPS1.16, wbmF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2q1ta_
  • Heterogens: NAD, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q1tA (A:)
    mgsshhhhhhssglvprgshmpvimnasklantnvmvvggagfvgsnlvkrllelgvnqv
    hvvdnllsaekinvpdhpavrfsetsitddallaslqdeydyvfhlatyhgnqssihdpl
    adhenntlttlklyerlkhfkrlkkvvysaagcsiaektfddakateetdivslhnndsp
    ysmskifgefysvyyhkqhqlptvrarfqnvygpgeilgagrwrgtpatvwrnvtptfiy
    kalkgmplplenggvatrdfifvedvangliacaadgtpggvyniasgketsiadlatki
    neitgnnteldrlpkrpwdnsgkrfgspekarrelgfsadvsiddglrktiewtkanlav
    ieqimrkhdsalatygk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q1tA (A:)
    nasklantnvmvvggagfvgsnlvkrllelgvnqvhvvdnllsaekinvpdhpavrfset
    sitddallaslqdeydyvfhlatyhgnqssihdpladhenntlttlklyerlkhfkrlkk
    vvysaageetdivslhnndspysmskifgefysvyyhkqhqlptvrarfqnvygpgeilg
    agrwrgtpatvwrnvtptfiykalkgmplplenggvatrdfifvedvangliacaadgtp
    ggvyniasgketsiadlatkineitgnnteldrlpkrpwdnfgspekarrelgfsadvsi
    ddglrktiewtkanlavieqimrkhdsalaty