PDB entry 2q1p

View 2q1p on RCSB PDB site
Description: Crystal Structure of Phospholipase A2 complex with propanol at 1.5 A resolution
Class: hydrolase
Keywords: phospholipase A2, propanol
Deposited on 2007-05-25, released 2007-06-05
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-05, with a file datestamp of 2007-06-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 VRV-PL-VIIIa
  Species: Daboia russelli pulchella
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-120)
  Domains in SCOP 1.73: d2q1pa1
• Heterogens: SO4, POL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2q1pA (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c