PDB entry 2q1m

View 2q1m on RCSB PDB site
Description: Crystal Structure of human GITRL
Class: signaling protein
Keywords: GITRL; Glucocorticoid-Induced TNF Receptor Ligand, SIGNALING PROTEIN
Deposited on 2007-05-24, released 2007-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF18, AITRL, GITRL, TL6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q1ma1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q1mA (A:)
    gshmetakepcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnany
    ndvapfevrlyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgi
    illanpqfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q1mA (A:)
    pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnanyndvapfevr
    lyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillan