PDB entry 2q1e

View 2q1e on RCSB PDB site
Description: Altered dimer interface decreases stability in an amyloidogenic kappa1 Bence Jones protein.
Class: protein fibril
Keywords: AL, light chain amyloidosis, amyloid, immunoglobulin, light chain, light chain variable domain, PROTEIN FIBRIL
Deposited on 2007-05-24, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.166
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-09
    Species: Homo sapiens [TaxId:9606]
    Gene: mutant of Vk1 O18/O8 germline
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q1ea_
  • Chain 'B':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-09
    Species: Homo sapiens [TaxId:9606]
    Gene: mutant of Vk1 O18/O8 germline
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q1eb_
  • Chain 'C':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-09
    Species: Homo sapiens [TaxId:9606]
    Gene: mutant of Vk1 O18/O8 germline
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q1ec_
  • Chain 'D':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-09
    Species: Homo sapiens [TaxId:9606]
    Gene: mutant of Vk1 O18/O8 germline
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q1ed_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q1eA (A:)
    atdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
    psrfsgsgsgteftftisslqpedlatyhcqqydnlpytfgqgtkleik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q1eB (B:)
    atdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
    psrfsgsgsgteftftisslqpedlatyhcqqydnlpytfgqgtkleik
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q1eC (C:)
    atdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
    psrfsgsgsgteftftisslqpedlatyhcqqydnlpytfgqgtkleik
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q1eD (D:)
    atdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
    psrfsgsgsgteftftisslqpedlatyhcqqydnlpytfgqgtkleik