PDB entry 2q16

View 2q16 on RCSB PDB site
Description: Structure of the E. coli inosine triphosphate pyrophosphatase RgdB in complex with ITP
Class: hydrolase
Keywords: ITP pyrophosphatase x-ray structure enzyme mechanism substrate, HYDROLASE
Deposited on 2007-05-23, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HAM1 protein homolog
    Species: Escherichia coli [TaxId:83333]
    Gene: yggV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52061 (20-216)
      • modified residue (20)
      • engineered (88)
      • modified residue (125)
    Domains in SCOPe 2.07: d2q16a_
  • Chain 'B':
    Compound: HAM1 protein homolog
    Species: Escherichia coli [TaxId:83333]
    Gene: yggV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52061
      • engineered (88)
      • modified residue (125)
    Domains in SCOPe 2.07: d2q16b_
  • Heterogens: CA, NA, SO4, ITT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q16A (A:)
    mgsshhhhhhssglvprgshmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsae
    etgltfienailkarhaakvtalpaiadasglavdvlggapgiysarysgedatdqknlq
    klletmkdvpddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydpif
    fvpsegktaaeltreeksaishrgqalkllldalrnggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q16A (A:)
    mqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfienailkarhaakv
    talpaiadasglavdvlggapgiysarysgedatdqknlqklletmkdvpddqrqarfhc
    vlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegktaaeltreeksai
    shrgqalkllldalrng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q16B (B:)
    mgsshhhhhhssglvprgshmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsae
    etgltfienailkarhaakvtalpaiadasglavdvlggapgiysarysgedatdqknlq
    klletmkdvpddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydpif
    fvpsegktaaeltreeksaishrgqalkllldalrnggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q16B (B:)
    kvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfienailkarhaakvta
    lpaiadasglavdvlggapgiysarysgedatdqknlqklletmkdvpddqrqarfhcvl
    vylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegktaaeltreeksaish
    rgqalkllldalr