PDB entry 2q15

View 2q15 on RCSB PDB site
Description: Structure of BACE complexed to compound 3a
Class: hydrolase
Keywords: bace inhibitor complex, hydrolase
Deposited on 2007-05-23, released 2007-08-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.256
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE1, BACE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56817 (0-384)
      • engineered (91)
      • engineered (110)
      • engineered (161)
      • engineered (292)
    Domains in SCOPe 2.04: d2q15a_
  • Heterogens: 3MR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q15A (A:)
    emvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlssty
    rdlrkgvyvpytqgkwegelgtdlvsiphgpqvtvraniaaitesdkffiqgsnwegilg
    layaeiarpddslepffdslvkqthvpnlfslqlcgagfplqqsevlasvggsmiiggid
    hslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkv
    feaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtqqsfriti
    lpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsach
    vhdefrtaavegpfvtldmedcgyn