PDB entry 2q0v

View 2q0v on RCSB PDB site
Description: Crystal structure of ubiquitin conjugating enzyme E2, putative, from Plasmodium falciparum
Class: ligase
Keywords: malaria, ubiquitin, E2, plasmodium, falciparum, Structural Genomics, Structural Genomics Consortium, SGC, LIGASE
Deposited on 2007-05-22, released 2007-06-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2, putative
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: MAL3P2.20, PFC0255c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O97241 (18-End)
      • cloning artifact (12-17)
    Domains in SCOPe 2.01: d2q0va_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q0vA (A:)
    mhhhhhhssgrenlyfqgivprsfrlldelergqkgnvsegvsfglesadditlsnwsct
    ifgqpgtvfenriysltifcddnypdspptvkfdtkiemscvdncgrviknnlhilknwn
    rnytietilislrqemlssankrlpqpnegevysnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q0vA (A:)
    nlyfqgivprsfrlldelergqkgvsegvsfglesadditlsnwsctifgqpgtvfenri
    ysltifcddnypdspptvkfdtkiemscvdncgrviknnlhilknwnrnytietilislr
    qemlssankrlpqpnegevy