PDB entry 2q07

View 2q07 on RCSB PDB site
Description: Crystal structure of AF0587, a protein of unknown function
Class: structural genomics, unknown function
Keywords: 10391c, protein AF0587, monomer, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2007-05-21, released 2007-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.245
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein AF0587
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Gene: AF_0587
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29668 (Start-297)
      • modified residue (175)
      • modified residue (213)
      • modified residue (276)
      • modified residue (281)
    Domains in SCOPe 2.07: d2q07a1, d2q07a2, d2q07a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q07A (A:)
    mslsalesssrfevryfferalecykpfsdtvlllpctarkpyltsrthralrskvkvnv
    neiiissplvvprefellypavnydtpvtghwseeevsfvagwlkrfiekggfrkvvahv
    tggyrkvvervedeveaevvytaekdvlsdesierlkqeieskgkvdlyrrilehmlsyq
    fgitwsgkvagrypelellegkkrlarvdriygmldiyekiaayllekniytveigdfev
    kgtifaggvlradekirpndvvvfhnsrifgvglaamsgkemagsekgiainvkrkfseg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q07A (A:)
    ryfferalecykpfsdtvlllpctarkpyltsrthralrskvkvnvneiiissplvvpre
    fellhwseeevsfvagwlkrfiekggfrkvvahvtggyrkvvervedeveaevvytaekd
    vlsdesierlkqeieskgkvdlyrrilehmlsyqfgitwsgkvagrypelellegkkrla
    rvdriygmldiyekiaayllekniytveigdfevkgtifaggvlradekirpndvvvfhn
    srifgvglaamsgkemagsgiainvkrkfs