PDB entry 2pzx

View 2pzx on RCSB PDB site
Description: Structure of the methuselah ectodomain with peptide inhibitor
Class: signaling protein
Keywords: GPCR G protein-coupled receptor ectodomain, SIGNALING PROTEIN
Deposited on 2007-05-18, released 2007-08-28
The last revision prior to the SCOP 1.75 freeze date was dated 2007-08-28, with a file datestamp of 2007-08-24.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.376
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G-protein coupled receptor Mth
    Species: Drosophila melanogaster
    Gene: mth
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pzxa1
  • Chain 'B':
    Compound: G-protein coupled receptor Mth
    Species: Drosophila melanogaster
    Gene: mth
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pzxb1
  • Chain 'C':
    Compound: G-protein coupled receptor Mth
    Species: Drosophila melanogaster
    Gene: mth
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pzxc1
  • Chain 'D':
    Compound: G-protein coupled receptor Mth
    Species: Drosophila melanogaster
    Gene: mth
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pzxd1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pzxA (A:)
    dilecdyfdtvdisaaqklqngsylfegllvpailtgeydfrilpddskqkvarhirgcv
    cklkpcvrfccphdhimdngvcydnmsdeelaeldpflnvtlddgsvsrrhfknelivqw
    dlpmpcdgmfyldnreeqdkytlfengtffrhfdrvtlrkreyclqhltfadgnatsiri
    aphncliv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pzxB (B:)
    dilecdyfdtvdisaaqklqngsylfegllvpailtgeydfrilpddskqkvarhirgcv
    cklkpcvrfccphdhimdngvcydnmsdeelaeldpflnvtlddgsvsrrhfknelivqw
    dlpmpcdgmfyldnreeqdkytlfengtffrhfdrvtlrkreyclqhltfadgnatsiri
    aphncliv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pzxC (C:)
    dilecdyfdtvdisaaqklqngsylfegllvpailtgeydfrilpddskqkvarhirgcv
    cklkpcvrfccphdhimdngvcydnmsdeelaeldpflnvtlddgsvsrrhfknelivqw
    dlpmpcdgmfyldnreeqdkytlfengtffrhfdrvtlrkreyclqhltfadgnatsiri
    aphncliv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pzxD (D:)
    dilecdyfdtvdisaaqklqngsylfegllvpailtgeydfrilpddskqkvarhirgcv
    cklkpcvrfccphdhimdngvcydnmsdeelaeldpflnvtlddgsvsrrhfknelivqw
    dlpmpcdgmfyldnreeqdkytlfengtffrhfdrvtlrkreyclqhltfadgnatsiri
    aphncliv