PDB entry 2pzm

View 2pzm on RCSB PDB site
Description: Crystal structure of the Bordetella bronchiseptica enzyme WbmG in complex with NAD and UDP
Class: Sugar Binding Protein
Keywords: ROSSMANN FOLD, PROTEIN-NAD COMPLEX, PROTEIN-NUCLEOTIDE COMPLEX, Sugar Binding Protein
Deposited on 2007-05-18, released 2007-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative nucleotide sugar epimerase/ dehydratase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BbLPS1.15, wbmG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87988 (20-End)
      • expression tag (13-19)
    Domains in SCOPe 2.06: d2pzma1, d2pzma2
  • Chain 'B':
    Compound: Putative nucleotide sugar epimerase/ dehydratase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BbLPS1.15, wbmG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87988 (20-End)
      • expression tag (13-19)
    Domains in SCOPe 2.06: d2pzmb1, d2pzmb2
  • Heterogens: SO4, NAD, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pzmA (A:)
    mgsshhhhhhssglvprgshmrilitggagclgsnliehwlpqgheilvidnfatgkrev
    lppvaglsviegsvtdagllerafdsfkpthvvhsaaaykdpddwaedaatnvqgsinva
    kaaskagvkrllnfqtalcygrpatvpipidsptapftsygisktageaflmmsdvpvvs
    lrlanvtgprlaigpiptfykrlkagqkcfcsdtvrdfldmsdflaiadlslqegrptgv
    fnvstgeghsikevfdvvldyvgatlaepvpvvapgaddvpsvvldpsktetefgwkakv
    dfkdtitgqlawydkygvtdifshlsapkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pzmA (A:)
    lvprgshmrilitggagclgsnliehwlpqgheilvidnfatgkrevlppvaglsviegs
    vtdagllerafdsfkpthvvhsaaaykdpddwaedaatnvqgsinvakaaskagvkrlln
    fqtalcygrpatvpipidsptapftsygisktageaflmmsdvpvvslrlanvtgprlai
    gpiptfykrlkagqkcfcsdtvrdfldmsdflaiadlslqegrptgvfnvstgeghsike
    vfdvvldyvgatlaepvpvvapgaddvpsvvldpsktetefgwkakvdfkdtitgqlawy
    dkygvtdifshlsapk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pzmB (B:)
    mgsshhhhhhssglvprgshmrilitggagclgsnliehwlpqgheilvidnfatgkrev
    lppvaglsviegsvtdagllerafdsfkpthvvhsaaaykdpddwaedaatnvqgsinva
    kaaskagvkrllnfqtalcygrpatvpipidsptapftsygisktageaflmmsdvpvvs
    lrlanvtgprlaigpiptfykrlkagqkcfcsdtvrdfldmsdflaiadlslqegrptgv
    fnvstgeghsikevfdvvldyvgatlaepvpvvapgaddvpsvvldpsktetefgwkakv
    dfkdtitgqlawydkygvtdifshlsapkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pzmB (B:)
    lvprgshmrilitggagclgsnliehwlpqgheilvidnfatgkrevlppvaglsviegs
    vtdagllerafdsfkpthvvhsaaaykdpddwaedaatnvqgsinvakaaskagvkrlln
    fqtalcygrpatvpipidsptapftsygisktageaflmmsdvpvvslrlanvtgprlai
    gpiptfykrlkagqkcfcsdtvrdfldmsdflaiadlslqegrptgvfnvstgeghsike
    vfdvvldyvgatlaepvpvvapgaddvpsvvldpsktetefgwkakvdfkdtitgqlawy
    dkygvtdifshls