PDB entry 2pzj

View 2pzj on RCSB PDB site
Description: Crystal structure of the Bordetella bronchiseptica enzyme WbmF in complex with NAD+
Class: Sugar binding protein
Keywords: BORDETELLA BRONCHISEPTICA, SHORT-CHAIN DEHYDROGENASE/REDUCTASE, O ANTIGEN, Sugar binding protein
Deposited on 2007-05-18, released 2007-10-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.163
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative nucleotide sugar epimerase/ dehydratase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BbLPS1.16, wbmF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2pzja_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pzjA (A:)
    mgsshhhhhhssglvprgshmpvimnasklantnvmvvggagfvgsnlvkrllelgvnqv
    hvvdnllsaekinvpdhpavrfsetsitddallaslqdeydyvfhlatyhgnqssihdpl
    adhenntlttlklyerlkhfkrlkkvvysaagcsiaektfddakateetdivslhnndsp
    ysmskifgefysvyyhkqhqlptvrarfqnvygpgeilgagrwrgtpatvwrnvtptfiy
    kalkgmplplenggvatrdfifvedvangliacaadgtpggvyniasgketsiadlatki
    neitgnnteldrlpkrpwdnsgkrfgspekarrelgfsadvsiddglrktiewtkanlav
    ieqimrkhdsalatygk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pzjA (A:)
    sklantnvmvvggagfvgsnlvkrllelgvnqvhvvdnllsaekinvpdhpavrfsetsi
    tddallaslqdeydyvfhlatyhgnqssihdpladhenntlttlklyerlkhfkrlkkvv
    ysaageetdivslhnndspysmskifgefysvyyhkqhqlptvrarfqnvygpgeilgag
    rwrgtpatvwrnvtptfiykalkgmplplenggvatrdfifvedvangliacaadgtpgg
    vyniasgketsiadlatkineitgnnteldrlpkrpwdnsgspekarrelgfsadvsidd
    glrktiewtkanlavieqimrkhdsalaty