PDB entry 2pzd

View 2pzd on RCSB PDB site
Description: Crystal Structure of the HtrA2/Omi PDZ Domain Bound to a Phage-Derived Ligand (WTMFWV)
Class: hydrolase
Keywords: PDZ domain, serine protease, apoptosis, mitochondria, peptide-binding module, HYDROLASE
Deposited on 2007-05-17, released 2007-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease HTRA2
    Species: Homo sapiens [TaxId:9606]
    Gene: HTRA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43464 (4-End)
      • linker residues (106)
      • see remark 999 (107-112)
    Domains in SCOPe 2.07: d2pzda_
  • Chain 'B':
    Compound: Serine protease HTRA2
    Species: Homo sapiens [TaxId:9606]
    Gene: HTRA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43464 (4-End)
      • linker residues (106)
      • see remark 999 (107-112)
    Domains in SCOPe 2.07: d2pzdb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pzdA (A:)
    gshmrryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvil
    aigeqmvqnaedvyeavrtqsqlavqirrgretltlyvtpevtegggwtmfwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pzdA (A:)
    rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige
    qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevtgwtmfwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pzdB (B:)
    gshmrryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvil
    aigeqmvqnaedvyeavrtqsqlavqirrgretltlyvtpevtegggwtmfwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pzdB (B:)
    rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige
    qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevtgwtmfwv