PDB entry 2pz3

View 2pz3 on RCSB PDB site
Description: Crystal structure of the AMF-bound conformation of a G-alpha-i1 mutant with enhanced GTPase activity
Class: hydrolase
Keywords: GTPase, G-protein, HYDROLYSIS, HYDROLASE
Deposited on 2007-05-17, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.305
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63096
      • engineered (201)
    Domains in SCOPe 2.07: d2pz3a1, d2pz3a2
  • Heterogens: MG, ALF, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pz3A (A:)
    mgctlsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheag
    yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
    aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
    ttgivethftfkdlhfkmfdvagqrserkkwihcfegvtaiifcvalsdydlvlaedeem
    nrmhesmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaa
    ayiqcqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pz3A (A:)
    lsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagysee
    eckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaefmtaelagv
    ikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyipqqdvlrtrvkttgivet
    hftfkdlhfkmfdvagqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesm
    klfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqf
    edlnkrkdtkeiythftcatdtknvqfvfdavtdviik