PDB entry 2pyu

View 2pyu on RCSB PDB site
Description: Structure of the E. coli inosine triphosphate pyrophosphatase RgdB in complex with IMP
Class: hydrolase
Keywords: ITP pyrophosphatase x-ray structure enzyme mechanism product, HYDROLASE
Deposited on 2007-05-16, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.195
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inosine Triphosphate Pyrophosphatase RdgB
    Species: Escherichia coli [TaxId:83333]
    Gene: yggV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52061 (20-End)
      • expression tag (8-19)
      • engineered (88)
    Domains in SCOPe 2.07: d2pyua1, d2pyua2
  • Heterogens: IMP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pyuA (A:)
    mgsshhhhhhssglvprgshmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsae
    etgltfienailkarhaakvtalpaiadasglavdvlggapgiysarysgedatdqknlq
    klletmkdvpddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydpif
    fvpsegktaaeltreeksaishrgqalkllldalrnggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pyuA (A:)
    hhssglvprgshmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfie
    nailkarhaakvtalpaiadasglavdvlggapgiysarysgedatdqknlqklletmkd
    vpddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegkt
    aaeltreeksaishrgqalkllldalrn