PDB entry 2pys

View 2pys on RCSB PDB site
Description: Crystal Structure of a Five Site Mutated Cyanovirin-N with a Mannose Dimer Bound at 1.8 A Resolution
Class: sugar binding protein
Keywords: cyanovirin-n, sugar binding protein, anti hiv
Deposited on 2007-05-16, released 2007-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Gene: CYANOVIRN-N
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (Start-100)
      • engineered (2)
      • engineered (6)
      • engineered (22)
      • engineered (50)
      • engineered (92)
      • cloning artifact (101)
    Domains in SCOPe 2.07: d2pysa1, d2pysa2
  • Chain 'B':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Gene: CYANOVIRN-N
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (Start-100)
      • engineered (2)
      • engineered (6)
      • engineered (22)
      • engineered (50)
      • engineered (92)
      • cloning artifact (101-102)
      • expression tag (103)
    Domains in SCOPe 2.07: d2pysb1, d2pysb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pysA (A:)
    lgnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrn
    tqlagsselaaecktraqqfvstkinlddhiaaidgtlkyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pysA (A:)
    gnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrnt
    qlagsselaaecktraqqfvstkinlddhiaaidgtlkyel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pysB (B:)
    lgnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrn
    tqlagsselaaecktraqqfvstkinlddhiaaidgtlkyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pysB (B:)
    gnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrnt
    qlagsselaaecktraqqfvstkinlddhiaaidgtlkyeleh