PDB entry 2pyr

View 2pyr on RCSB PDB site
Description: photoactive yellow protein, 1 nanosecond intermediate (287k)
Class: photoreceptor
Keywords: photoreceptor, light sensor for negative phototaxis
Deposited on 1998-03-04, released 1999-04-06
The last revision prior to the SCOP 1.75 freeze date was dated 1999-04-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: Ectothiorhodospira halophila
  Gene: P16113
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
  Domains in SCOP 1.75: d2pyra_
• Heterogens: HC4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pyrA (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv