PDB entry 2pyq

View 2pyq on RCSB PDB site
Description: Crystal structure of a duf2853 member protein (jann_4075) from jannaschia sp. ccs1 at 1.500 A resolution
Class: unknown function
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2007-05-16, released 2007-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Jannaschia sp. CCS1 [TaxId:290400]
    Gene: YP_512017.1, Jann_4075
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28JX0 (1-113)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (21)
      • modified residue (25)
      • modified residue (64)
      • modified residue (76)
      • modified residue (101)
    Domains in SCOPe 2.08: d2pyqa1, d2pyqa2
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Jannaschia sp. CCS1 [TaxId:290400]
    Gene: YP_512017.1, Jann_4075
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28JX0 (1-113)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (21)
      • modified residue (25)
      • modified residue (64)
      • modified residue (76)
      • modified residue (101)
    Domains in SCOPe 2.08: d2pyqb2, d2pyqb3
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Jannaschia sp. CCS1 [TaxId:290400]
    Gene: YP_512017.1, Jann_4075
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28JX0 (1-113)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (21)
      • modified residue (25)
      • modified residue (64)
      • modified residue (76)
      • modified residue (101)
    Domains in SCOPe 2.08: d2pyqc2, d2pyqc3
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Jannaschia sp. CCS1 [TaxId:290400]
    Gene: YP_512017.1, Jann_4075
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28JX0 (1-113)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (21)
      • modified residue (25)
      • modified residue (64)
      • modified residue (76)
      • modified residue (101)
    Domains in SCOPe 2.08: d2pyqd2, d2pyqd3
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pyqA (A:)
    gmgkrddliaqyaddlrnkcgmepdmallekvtkgcgpaiynrdastvagsdtaeletik
    knflmkklgladseslmggiqsvietygrsernkyravvyymltkhfgkesvyg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pyqB (B:)
    gmgkrddliaqyaddlrnkcgmepdmallekvtkgcgpaiynrdastvagsdtaeletik
    knflmkklgladseslmggiqsvietygrsernkyravvyymltkhfgkesvyg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pyqC (C:)
    gmgkrddliaqyaddlrnkcgmepdmallekvtkgcgpaiynrdastvagsdtaeletik
    knflmkklgladseslmggiqsvietygrsernkyravvyymltkhfgkesvyg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pyqD (D:)
    gmgkrddliaqyaddlrnkcgmepdmallekvtkgcgpaiynrdastvagsdtaeletik
    knflmkklgladseslmggiqsvietygrsernkyravvyymltkhfgkesvyg