PDB entry 2pyp

View 2pyp on RCSB PDB site
Description: photoactive yellow protein, photostationary state, 50% ground state, 50% bleached
Class: photoreceptor
Keywords: photoreceptor, chromophore, light sensor for phototaxis
Deposited on 1997-02-03, released 1998-04-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: Halorhodospira halophila [TaxId:1053]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
  Domains in SCOPe 2.01: d2pypa_
• Heterogens: HC4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pypA (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv