PDB entry 2pyn

View 2pyn on RCSB PDB site
Description: HIV-1 PR mutant in complex with nelfinavir
Class: hydrolase
Keywords: resistance; nelfinavir, HYDROLASE
Deposited on 2007-05-16, released 2008-02-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (29)
    • engineered (40)
    • engineered (70)
  Domains in SCOPe 2.04: d2pyna_
• Chain 'B':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (29)
    • engineered (40)
    • engineered (70)
  Domains in SCOPe 2.04: d2pynb_
• Heterogens: 1UN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pynA (A:)
  pqitlwqrplvtikiggqlkealldtgadntvleemslpgawkpkmiggiggfikvrqyd
  qilieicghkvigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pynB (B:)
  pqitlwqrplvtikiggqlkealldtgadntvleemslpgawkpkmiggiggfikvrqyd
  qilieicghkvigtvlvgptpvniigrnlltqigctlnf