PDB entry 2pym
View 2pym on RCSB PDB site
Description: HIV-1 PR mutant in complex with nelfinavir
Class: hydrolase
Keywords: resistance; nelfinavir, HYDROLASE
Deposited on
2007-05-16, released
2008-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (29)
- engineered (40)
- engineered (87)
Domains in SCOPe 2.07: d2pyma_ - Chain 'B':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (29)
- engineered (40)
- engineered (87)
Domains in SCOPe 2.07: d2pymb_ - Heterogens: 1UN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2pymA (A:)
pqitlwqrplvtikiggqlkealldtgadntvleemslpgawkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrdlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2pymB (B:)
pqitlwqrplvtikiggqlkealldtgadntvleemslpgawkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrdlltqigctlnf