PDB entry 2pyi

View 2pyi on RCSB PDB site
Description: Crystal structure of Glycogen Phosphorylase in complex with glucosyl triazoleacetamide
Class: transferase
Keywords: glycogenolysis, inhibition, type 2 diabetes, transferase
Deposited on 2007-05-16, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • modified residue (680)
    Domains in SCOPe 2.07: d2pyia_
  • Heterogens: DL8, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pyiA (A:)
    msrplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtv
    rdhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldm
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeea
    ddwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvn
    tmrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerl
    dwdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafp
    gdvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkf
    qnktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkq
    enklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvv
    prtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipa
    adlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvd
    rldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyee
    yvkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapde
    kip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pyiA (A:)
    rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
    tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
    glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
    ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
    ngyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkssknfda
    fpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerwp
    vhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciag
    shavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerig
    eeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvk
    riheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigd
    vvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngalt
    igtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssg
    ffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniats
    gkfssdrtiaqyareiwgvepsrqrlp