PDB entry 2pyf

View 2pyf on RCSB PDB site
Description: Crystal Structures of High Affinity Human T-Cell Receptors Bound to pMHC RevealNative Diagonal Binding Geometry Unbound TCR Clone 5-1
Class: immune system
Keywords: T-cell receptor, cdr3, phage display, mutant, high affinity, ny-eso-1, immune system
Deposited on 2007-05-16, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor, alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pyfa1, d2pyfa2
  • Chain 'B':
    Compound: T-cell receptor, beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pyfb1, d2pyfb2
  • Heterogens: SO4, PGE, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pyfA (A:)
    kqevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqtsg
    rlnasldkssgsstlyiaasqpgdsatylcavrplldgtyiptfgrgtslivhpyiqnpd
    pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
    nksdfacanafnnsiipdtffpspe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pyfB (B:)
    gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagttdqgevpn
    gynvsrstiedfplrllsaapsqtsvyfcassylgntgelffgegsrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d