PDB entry 2pyc

View 2pyc on RCSB PDB site
Description: Crystal structure of a monomeric phospholipase A2 from Russell's viper at 1.5A resolution
Class: hydrolase
Keywords: Active site, Toxin
Deposited on 2007-05-16, released 2007-05-29
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.182
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 VRV-PL-VIIIa
    Species: Daboia russelli pulchella
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2pyca1
  • Heterogens: ACT, SO4, CCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pycA (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c