PDB entry 2pyb

View 2pyb on RCSB PDB site
Description: Napa protein from borrelia burgdorferi
Class: metal transport
Keywords: Ferritin, Dps, FOUR-HELIX BUNDLE, METAL TRANSPORT
Deposited on 2007-05-16, released 2008-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.242
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil activating protein
    Species: Borrelia burgdorferi
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pyba_
  • Chain 'B':
    Compound: Neutrophil activating protein
    Species: Borrelia burgdorferi
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pybb_
  • Chain 'C':
    Compound: Neutrophil activating protein
    Species: Borrelia burgdorferi
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pybc_
  • Chain 'D':
    Compound: Neutrophil activating protein
    Species: Borrelia burgdorferi
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pybd_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pybA (A:)
    ddldaiqlklqellaslhifysnlrgihwnikdtnffvihkktqklyeyiekiidivaer
    srmlgydsefrysefmkksfikeldiestsnflpsmesivcslteilknifgmrklidta
    gdygtanimddimsdlekhlwmhkallencd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pybB (B:)
    ddldaiqlklqellaslhifysnlrgihwnikdtnffvihkktqklyeyiekiidivaer
    srmlgydsefrysefmkksfikeldiestsnflpsmesivcslteilknifgmrklidta
    gdygtanimddimsdlekhlwmhkallencd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pybC (C:)
    ddldaiqlklqellaslhifysnlrgihwnikdtnffvihkktqklyeyiekiidivaer
    srmlgydsefrysefmkksfikeldiestsnflpsmesivcslteilknifgmrklidta
    gdygtanimddimsdlekhlwmhkallencd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pybD (D:)
    ddldaiqlklqellaslhifysnlrgihwnikdtnffvihkktqklyeyiekiidivaer
    srmlgydsefrysefmkksfikeldiestsnflpsmesivcslteilknifgmrklidta
    gdygtanimddimsdlekhlwmhkallencd