PDB entry 2py9

View 2py9 on RCSB PDB site
Description: Protein-RNA Interaction involving KH1 domain from Human Poly(C)-Binding Protein-2
Class: RNA AND DNA binding protein/RNA
Keywords: protein-RNA complex
Deposited on 2007-05-15, released 2007-06-12
The last revision prior to the SCOP 1.75 freeze date was dated 2007-07-24, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.22
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(rC)-binding protein 2
    Species: HOMO SAPIENS
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366 (1-End)
      • cloning artifact (0)
      • modified residue (10)
      • modified residue (29)
      • modified residue (64)
    Domains in SCOP 1.75: d2py9a1
  • Chain 'B':
    Compound: Poly(rC)-binding protein 2
    Species: HOMO SAPIENS
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366
      • modified residue (10)
      • modified residue (29)
      • modified residue (64)
    Domains in SCOP 1.75: d2py9b1
  • Chain 'C':
    Compound: Poly(rC)-binding protein 2
    Species: HOMO SAPIENS
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366
      • modified residue (10)
      • modified residue (29)
      • modified residue (64)
    Domains in SCOP 1.75: d2py9c1
  • Chain 'D':
    Compound: Poly(rC)-binding protein 2
    Species: HOMO SAPIENS
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366
      • modified residue (10)
      • modified residue (29)
      • modified residue (64)
    Domains in SCOP 1.75: d2py9d1
  • Chain 'E':
    Compound: 12-mer C-rich strand of human telomeric RNA
  • Chain 'F':
    Compound: 12-mer C-rich strand of human telomeric RNA
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2py9A (A:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidkleed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py9A (A:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidklee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2py9B (B:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidkleed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py9B (B:)
    tltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifkaf
    amiidklee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2py9C (C:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidkleed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py9C (C:)
    tltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifkaf
    amiidklee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2py9D (D:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidkleed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py9D (D:)
    tltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifkaf
    amiidklee
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.