PDB entry 2py4

View 2py4 on RCSB PDB site
Description: Full length structure of the Mycobacterium tuberculosis dUTPase complexed with magnesium and alpha,beta-imido-dUTP.
Class: hydrolase
Keywords: JELLY-ROLL, enzyme-ligand complex, HYDROLASE
Deposited on 2007-05-15, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.146
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dut
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2py4a_
  • Heterogens: MG, DUP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2py4A (A:)
    mgsshhhhhhssglvprgshmsttlaivrldpglplpsrahdgdagvdlysaedvelapg
    rralvrtgvavavpfgmvglvhprsglatrvglsivnspgtidagyrgeikvalinldpa
    apivvhrgdriaqllvqrvelvelvevssfdeaglastsrgdgghgssgghasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py4A (A:)
    sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv
    hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel
    velvevssfdeaglastsrgdgghgssgghasl