PDB entry 2py2

View 2py2 on RCSB PDB site
Description: Structure of Herring Type II Antifreeze Protein
Class: antifreeze protein
Keywords: type II antifreeze protein
Deposited on 2007-05-15, released 2007-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antifreeze protein type II
    Species: Clupea harengus [TaxId:7950]
    Gene: hAFP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2py2a_
  • Chain 'B':
    Compound: Antifreeze protein type II
    Species: Clupea harengus [TaxId:7950]
    Gene: hAFP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2py2b_
  • Chain 'C':
    Compound: Antifreeze protein type II
    Species: Clupea harengus [TaxId:7950]
    Gene: hAFP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2py2c_
  • Chain 'D':
    Compound: Antifreeze protein type II
    Species: Clupea harengus [TaxId:7950]
    Gene: hAFP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2py2d_
  • Chain 'E':
    Compound: Antifreeze protein type II
    Species: Clupea harengus [TaxId:7950]
    Gene: hAFP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2py2e_
  • Chain 'F':
    Compound: Antifreeze protein type II
    Species: Clupea harengus [TaxId:7950]
    Gene: hAFP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2py2f_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2py2A (A:)
    adecptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadli
    pswiggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthl
    hssicakplkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py2A (A:)
    cptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadlipsw
    iggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthlhss
    icakplk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2py2B (B:)
    adecptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadli
    pswiggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthl
    hssicakplkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py2B (B:)
    cptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadlipsw
    iggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthlhss
    icakplk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2py2C (C:)
    adecptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadli
    pswiggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthl
    hssicakplkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py2C (C:)
    cptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadlipsw
    iggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthlhss
    icakplk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2py2D (D:)
    adecptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadli
    pswiggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthl
    hssicakplkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py2D (D:)
    cptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadlipsw
    iggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthlhss
    icakplk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2py2E (E:)
    adecptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadli
    pswiggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthl
    hssicakplkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py2E (E:)
    cptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadlipsw
    iggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthlhss
    icakplk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2py2F (F:)
    adecptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadli
    pswiggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthl
    hssicakplkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py2F (F:)
    cptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadlipsw
    iggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthlhss
    icakplk