PDB entry 2py0

View 2py0 on RCSB PDB site
Description: Crystal structure of Cs1 pilin chimera
Class: cell adhesion
Keywords: type IV pilus, consensus sequence, pseudomonas aeruginosa, monomeric pilin, cell adhesion
Deposited on 2007-05-14, released 2007-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.172
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fimbrial protein
  Species: PSEUDOMONAS AERUGINOSA [TaxId:287]
  Gene: PILA, FIMA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02973 (5-119)
    • expression tag (0-4)
    • engineered (106)
    • engineered (111)
  Domains in SCOPe 2.08: d2py0a1, d2py0a2
• Heterogens: EPE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2py0A (A:)
  egtafarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklg
  tialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkcksdqdpqfipkgcs