SCOPe 2.06: Structural Classification of Proteins

PDB entry 2pxr

View 2pxr on RCSB PDB site
Description: Crystal Structure of HIV-1 CA146 in the Presence of CAP-1
Class: viral protein
Keywords: Viral Capsid, HIV-1, Anti-Viral, Small molecule inhibition, VIRAL PROTEIN
Deposited on 2007-05-14, released 2007-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.166
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

Chain 'C':
Compound: Gag-Pol polyprotein (Pr160Gag-Pol)
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P12497 (0-End)
Domains in SCOPe 2.06: d2pxrc_
Heterogens: CL, ZN, HOH

PDB Chain Sequences:

Chain 'C':
Sequence, based on SEQRES records: (download)

>2pxrC (C:)
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

Sequence, based on observed residues (ATOM records): (download)

>2pxrC (C:)
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy