PDB entry 2pxk

View 2pxk on RCSB PDB site
Description: Variant 8 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
Class: signaling protein/RNA
Keywords: gu pair, hexamine, RNA phasing, RNA, cation binding, signaling protein/RNA complex
Deposited on 2007-05-14, released 2007-08-07
The last revision prior to the SCOP 1.75 freeze date was dated 2007-08-07, with a file datestamp of 2007-08-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.275
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle protein
    Species: Escherichia coli
    Gene: FFH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGD7 (0-101)
      • modified residue (8)
      • modified residue (47)
      • modified residue (54)
      • modified residue (56)
      • engineered (77)
      • modified residue (79)
      • modified residue (94)
      • modified residue (97-98)
      • modified residue (101)
    Domains in SCOP 1.75: d2pxka1
  • Chain 'B':
    Compound: 4.5 s RNA
    Species: synthetic, synthetic
  • Heterogens: NCO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pxkA (A:)
    fdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmker
    akpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pxkA (A:)
    fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
    dmqrmmkkm
    

  • Chain 'B':
    No sequence available.