PDB entry 2pxf

View 2pxf on RCSB PDB site
Description: Variant 5 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
Class: signaling protein/RNA
Keywords: gu pair, hexamine, RNA phasing, RNA, cation binding, signaling protein/RNA complex
Deposited on 2007-05-14, released 2007-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.268
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: signal recognition particle protein
  Species: Escherichia coli [TaxId:562]
  Gene: FFH
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AGD7 (0-101)
    • modified residue (8)
    • modified residue (47)
    • modified residue (54)
    • modified residue (56)
    • engineered (77)
    • modified residue (79)
    • modified residue (94)
    • modified residue (97-98)
    • modified residue (101)
  Domains in SCOPe 2.06: d2pxfa_
• Chain 'B':
  Compound: 4.5 s RNA
  Species: synthetic, synthetic
  
• Heterogens: NCO

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2pxfA (A:)
  fdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmker
  akpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkm
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2pxfA (A:)
  fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
  dmqrmmkkm
  

  
  
• Chain 'B':
  No sequence available.