PDB entry 2pws

View 2pws on RCSB PDB site
Description: Crystal structure of the complex formed between phospholipase A2 and 2-(4-isobutyl-phenyl)-propionic acid at 2.2 A resolution
Class: hydrolase
Keywords: NSAIDs, Active site, Inhibitor, hydrolase
Deposited on 2007-05-13, released 2007-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.182
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 VRV-PL-VIIIa
  Species: Daboia russellii pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-120)
  Domains in SCOPe 2.08: d2pwsa_
• Heterogens: IBP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pwsA (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c