PDB entry 2pwq

View 2pwq on RCSB PDB site
Description: Crystal structure of a putative ubiquitin conjugating enzyme from Plasmodium yoelii
Class: ligase
Keywords: Ubiquitin conjugating enzyme, Plasmodium yoelii, Structural Genomics Consortium, SGC, LIGASE
Deposited on 2007-05-11, released 2007-05-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.269
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin conjugating enzyme
    Species: Plasmodium yoelii [TaxId:5861]
    Gene: PY01609
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7RP52 (21-End)
      • cloning artifact (18-20)
    Domains in SCOPe 2.05: d2pwqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pwqA (A:)
    mgsshhhhhhssgrenlyfqgskellrlqkelkdienenvqeidahikdsnffewvgfik
    gpegtpyegghftlaitipndypynppkikfvtkiwhpnissqtgaicldvlknewspal
    tirtallsiqallsdpqpddpqdaevakmykenhalfvktasvwtktfatgpkeeprevi
    ikkitemgfsedqaknalikanwnetlalntllens
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwqA (A:)
    fqgskellrlqkelkdienenvqeidahikdsnffewvgfikgpegtpyegghftlaiti
    pndypynppkikfvtkiwhpnissqtgaicldvlknewspaltirtallsiqallsdpqp
    ddpqdaevakmykenhalfvktasvwtktfatgp