PDB entry 2pwm

View 2pwm on RCSB PDB site
Description: Crystal Structure of HIV-1 CA146 A92E real cell
Class: viral protein
Keywords: Viral Capsid, HIV-1, Anti-Viral, VIRAL PROTEIN
Deposited on 2007-05-11, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (91)
    Domains in SCOPe 2.07: d2pwma_
  • Chain 'B':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pwmb_
  • Chain 'C':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (91)
    Domains in SCOPe 2.07: d2pwmc_
  • Chain 'D':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (91)
    Domains in SCOPe 2.07: d2pwmd_
  • Chain 'E':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (91)
    Domains in SCOPe 2.07: d2pwme_
  • Chain 'F':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pwmf_
  • Chain 'G':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (91)
    Domains in SCOPe 2.07: d2pwmg_
  • Chain 'H':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (91)
    Domains in SCOPe 2.07: d2pwmh_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pwmA (A:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwmA (A:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pwmB (B:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwmB (B:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhmreprgsdiagttstlqeqigwmthnppipvge
    iykrwiilglnkivrmy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pwmC (C:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwmC (C:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pwmD (D:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwmD (D:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2pwmE (E:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwmE (E:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2pwmF (F:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwmF (F:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhmreprgsdiagttstlqeqigwmthnppipvge
    iykrwiilglnkivrmy
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2pwmG (G:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwmG (G:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2pwmH (H:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwmH (H:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmy