PDB entry 2pwg

View 2pwg on RCSB PDB site
Description: Crystal Structure of the Trehalulose Synthase MutB From Pseudomonas Mesoacidophila MX-45 Complexed to the Inhibitor Castanospermine
Class: Isomerase
Keywords: trehalulose synthase, sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel, enzyme inhibitor complex
Deposited on 2007-05-11, released 2007-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sucrose isomerase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Gene: mutB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pwga1, d2pwga2
  • Chain 'B':
    Compound: Sucrose isomerase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Gene: mutB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pwgb1, d2pwgb2
  • Heterogens: CA, CTS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pwgA (A:)
    pgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntd
    ngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdn
    pyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklree
    lyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhe
    kvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtlad
    frqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtp
    fifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpf
    qwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgsy
    rdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaaga
    aslelqpwqsgiykvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pwgB (B:)
    pgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntd
    ngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdn
    pyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklree
    lyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhe
    kvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtlad
    frqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtp
    fifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpf
    qwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgsy
    rdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaaga
    aslelqpwqsgiykvk