PDB entry 2pwf

View 2pwf on RCSB PDB site
Description: Crystal structure of the MutB D200A mutant in complex with glucose
Class: Isomerase
Keywords: TREHALULOSE SYNTHASE, SUCROSE ISOMERASE, ALPHA-AMYLASE FAMILY, (BETA/ALPHA)8, BARREL, enzyme complex
Deposited on 2007-05-11, released 2007-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sucrose isomerase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Gene: mutB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2PS28 (Start-555)
      • engineered (198)
    Domains in SCOPe 2.06: d2pwfa1, d2pwfa2
  • Chain 'B':
    Compound: Sucrose isomerase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Gene: mutB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2PS28 (Start-555)
      • engineered (198)
    Domains in SCOPe 2.06: d2pwfb1, d2pwfb2
  • Chain 'C':
    Compound: Sucrose isomerase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Gene: mutB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2PS28 (0-555)
      • engineered (198)
    Domains in SCOPe 2.06: d2pwfc1, d2pwfc2
  • Chain 'D':
    Compound: Sucrose isomerase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Gene: mutB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2PS28 (0-555)
      • engineered (198)
    Domains in SCOPe 2.06: d2pwfd1, d2pwfd2
  • Heterogens: BGC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pwfA (A:)
    pgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntd
    ngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdn
    pyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklree
    lyamlrfwldkgvsgmrfatvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhe
    kvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtlad
    frqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtp
    fifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpf
    qwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgsy
    rdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaaga
    aslelqpwqsgiykvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwfA (A:)
    gapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntdn
    gydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdnp
    yrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklreel
    yamlrfwldkgvsgmrfatvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhek
    vfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtladf
    rqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtpf
    ifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpfq
    wddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgsyr
    didpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaagaa
    slelqpwqsgiykvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pwfB (B:)
    pgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntd
    ngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdn
    pyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklree
    lyamlrfwldkgvsgmrfatvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhe
    kvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtlad
    frqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtp
    fifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpf
    qwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgsy
    rdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaaga
    aslelqpwqsgiykvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwfB (B:)
    apwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntdng
    ydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdnpy
    rdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklreely
    amlrfwldkgvsgmrfatvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhekv
    fdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtladfr
    qtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtpfi
    fqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpfqw
    ddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgsyrd
    idpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaagaas
    lelqpwqsgiykvk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pwfC (C:)
    pgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntd
    ngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdn
    pyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklree
    lyamlrfwldkgvsgmrfatvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhe
    kvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtlad
    frqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtp
    fifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpf
    qwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgsy
    rdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaaga
    aslelqpwqsgiykvk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pwfD (D:)
    pgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntd
    ngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdn
    pyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklree
    lyamlrfwldkgvsgmrfatvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhe
    kvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtlad
    frqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtp
    fifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpf
    qwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgsy
    rdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaaga
    aslelqpwqsgiykvk