PDB entry 2pwe

View 2pwe on RCSB PDB site
Description: Crystal structure of the MutB E254Q mutant in complex with the substrate sucrose
Class: Isomerase
Keywords: TREHALULOSE SYNTHASE, SUCROSE ISOMERASE, ALPHA-AMYLASE FAMILY, (BETA/ALPHA)8, BARREL, enzyme-substrate complex
Deposited on 2007-05-11, released 2007-06-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sucrose isomerase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Gene: mutB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2PS28 (0-555)
      • engineered (252)
    Domains in SCOPe 2.03: d2pwea1, d2pwea2
  • Chain 'B':
    Compound: Sucrose isomerase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Gene: mutB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2PS28 (0-555)
      • engineered (252)
    Domains in SCOPe 2.03: d2pweb1, d2pweb2
  • Heterogens: SUC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pweA (A:)
    pgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntd
    ngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdn
    pyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklree
    lyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhe
    kvfdhydavtagqifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtlad
    frqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtp
    fifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpf
    qwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgsy
    rdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaaga
    aslelqpwqsgiykvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pweB (B:)
    pgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntd
    ngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdn
    pyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklree
    lyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhe
    kvfdhydavtagqifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtlad
    frqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtp
    fifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpf
    qwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgsy
    rdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaaga
    aslelqpwqsgiykvk