PDB entry 2pw7

View 2pw7 on RCSB PDB site
Description: Crystal Structure of Staphylococcal nuclease variant V66Y/P117G/H124L/S128A at 100K
Class: hydrolase
Keywords: Staphylococcal nuclease, nuclease, hyperstable variant, internal waters, hydrolase
Deposited on 2007-05-10, released 2008-04-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NXI6
      • engineered (65)
      • engineered (116)
      • engineered (127)
    Domains in SCOPe 2.05: d2pw7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pw7A (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmyenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnnt
    heqllrkaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pw7A (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkvekygpeasaftkkmyenakk
    ievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaq
    akkeklniws