PDB entry 2pw3

View 2pw3 on RCSB PDB site
Description: Structure of the PDE4D-cAMP complex
Class: hydrolase
Keywords: PDE4-cAMP complex, substrate specificity, crystal structure., HYDROLASE
Deposited on 2007-05-10, released 2007-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.212
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08499 (0-326)
      • engineered (115)
    Domains in SCOPe 2.07: d2pw3a_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08499 (Start-326)
      • engineered (115)
    Domains in SCOPe 2.07: d2pw3b_
  • Heterogens: ZN, CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pw3A (A:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihnvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstipq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pw3B (B:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihnvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstipq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pw3B (B:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihnvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
    lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
    vhpdaqdildtlednrewyqstipq