PDB entry 2pw2

View 2pw2 on RCSB PDB site
Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELDKWKSL
Class: immune system
Keywords: HIV-1, gp41, 2F5, neutralizing antibody, IMMUNE SYSTEM
Deposited on 2007-05-10, released 2007-05-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.218
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2F5 Fab' heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2PW2 (0-213)
  • Chain 'B':
    Compound: 2F5 Fab' light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2PW2 (0-End)
    Domains in SCOPe 2.05: d2pw2b1, d2pw2b2
  • Chain 'C':
    Compound: peptide epitope
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2PW2 (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pw2B (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapsskstaggtaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pw2B (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpsssqtytcnvnhkpsntkvdkrvep
    

  • Chain 'C':
    No sequence available.