PDB entry 2pw1

View 2pw1 on RCSB PDB site
Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELDKWNSL
Class: immune system
Keywords: HIV-1, 2F5, gp41, neutralizing antibody
Deposited on 2007-05-10, released 2007-05-22
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2F5 Fab fragment heavy chain
    Species: HOMO SAPIENS
  • Chain 'B':
    Compound: 2F5 Fab fragment light chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d2pw1b1, d2pw1b2
  • Chain 'C':
    Compound: peptide epitope
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pw1B (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapsskstaggtaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pw1B (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpsssqtytcnvnhkpsntkvdkrvep
    

  • Chain 'C':
    No sequence available.