PDB entry 2pvt

View 2pvt on RCSB PDB site
Description: Crystal structure of a new isoform of phospholipase A2 from russells viper at 2.1 A resolution
Class: hydrolase
Keywords: Catalysis, Active site, Isoform, HYDROLASE
Deposited on 2007-05-10, released 2007-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.167
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Daboia russellii pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-116)
  Domains in SCOPe 2.06: d2pvta_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pvtA (A:)
  sliefgkmileetgklaipsyssygcycggggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcedgtscqnricecdkaaaicfrqnlttysekyelypdflckgkik
  c