PDB entry 2pvo

View 2pvo on RCSB PDB site
Description: Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase
Class: electron transport
Keywords: Thioredoxin, ferredoxin. redox, iron-sulfur cluster, protein-protein complex, Electron Transport
Deposited on 2007-05-09, released 2007-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin-thioredoxin reductase, catalytic chain
    Species: Synechocystis sp. [TaxId:1143]
    Gene: ftrC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pvoa1
  • Chain 'B':
    Compound: Ferredoxin-thioredoxin reductase, variable chain
    Species: Synechocystis sp. [TaxId:1143]
    Gene: ftrV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pvob1
  • Chain 'C':
    Compound: Thioredoxin F-type, chloroplast
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09856 (0-110)
      • engineered (38)
  • Chain 'D':
    Compound: Ferredoxin-1
    Species: Synechocystis sp. [TaxId:1143]
    Gene: petF, fed
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27320 (0-95)
      • conflict (33)
  • Heterogens: SO4, SF4, FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pvoA (A:)
nktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeaev
kntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkasma

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pvoB (B:)
mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
fkahfrpdevtlie

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.