PDB entry 2pvi

View 2pvi on RCSB PDB site
Description: pvuii endonuclease complexed to an iodinated cognate DNA
Class: hydrolase/DNA
Keywords: complex (restriction endonuclease/DNA), hydrolase/DNA complex
Deposited on 1998-11-01, released 1998-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.188
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23657 (Start-156)
      • engineered (54)
      • engineered (93)
    Domains in SCOPe 2.06: d2pvia_
  • Chain 'B':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23657 (Start-156)
      • engineered (54)
      • engineered (93)
    Domains in SCOPe 2.06: d2pvib_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*gp*ap*cp*cp*ap*gp*(c38)p*tp*gp*gp*tp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*ap*cp*cp*ap*gp*(c38)p*tp*gp*gp*tp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pviA (A:)
    mshpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgragndav
    dnagqeyelksinidltkgfsthhhmnpviiakarqvpwifaiyrgiaieaiyrlepkdl
    efyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pviA (A:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgragndavd
    nagqeyelksinidltkgfsthhhmnpviiakarqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pviB (B:)
    mshpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgragndav
    dnagqeyelksinidltkgfsthhhmnpviiakarqvpwifaiyrgiaieaiyrlepkdl
    efyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pviB (B:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgragndavd
    nagqeyelksinidltkgfsthhhmnpviiakarqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.