PDB entry 2pvb

View 2pvb on RCSB PDB site
Description: pike parvalbumin (pi 4.10) at low temperature (100k) and atomic resolution (0.91 a).
Class: metal binding protein
Keywords: calcium binding protein, metal binding protein
Deposited on 1998-10-02, released 1998-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.91 Å
R-factor: 0.11
AEROSPACI score: 1.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (parvalbumin)
    Species: Esox lucius [TaxId:8010]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pvba_
  • Heterogens: CA, NH4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pvbA (A:)
    sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
    elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika