PDB entry 2pv7

View 2pv7 on RCSB PDB site
Description: Crystal structure of chorismate mutase / prephenate dehydrogenase (tyrA) (1574749) from Haemophilus influenzae RD at 2.00 A resolution
Class: isomerase, oxidoreductase
Keywords: 1574749, Chorismate mutase type II, chorismate mutase / prephenate dehydrogenase (tyrA), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, ISOMERASE, OXIDOREDUCTASE
Deposited on 2007-05-09, released 2007-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-protein [Includes: Chorismate mutase (EC 5.4.99.5) (CM) and Prephenate dehydrogenase (EC 1.3.1.12) (PDH)]
    Species: Haemophilus influenzae [TaxId:727]
    Gene: 1574749, tyrA, HI1290
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43902
      • modified residue (92)
      • modified residue (108)
      • modified residue (122)
      • modified residue (130)
      • modified residue (172)
      • modified residue (214)
      • modified residue (231)
    Domains in SCOPe 2.08: d2pv7a1, d2pv7a2
  • Chain 'B':
    Compound: T-protein [Includes: Chorismate mutase (EC 5.4.99.5) (CM) and Prephenate dehydrogenase (EC 1.3.1.12) (PDH)]
    Species: Haemophilus influenzae [TaxId:727]
    Gene: 1574749, tyrA, HI1290
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43902
      • modified residue (92)
      • modified residue (108)
      • modified residue (122)
      • modified residue (130)
      • modified residue (172)
      • modified residue (214)
      • modified residue (231)
    Domains in SCOPe 2.08: d2pv7b1, d2pv7b2
  • Heterogens: TYR, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pv7A (A:)
    gmresyanenqfgfktinsdihkivivggygklgglfarylrasgypisildredwavae
    silanadvvivsvpinltletierlkpyltenmlladltsvkreplakmlevhtgavlgl
    hpmfgadiasmakqvvvrcdgrfperyewlleqiqiwgakiyqtnatehdhnmtyiqalr
    hfstfanglhlskqpinlanllalsspiyrlelamigrlfaqdaelyadiimdksenlav
    ietlkqtydealtffenndrqgfidafhkvrdwfgdyseqflkesrqllqqandlkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pv7A (A:)
    gfktinsdihkivivggygklgglfarylrasgypisildredwavaesilanadvvivs
    vpinltletierlkpyltenmlladltsvkreplakmlevhtgavlglhpmfgadiasma
    kqvvvrcdgrfperyewlleqiqiwgakiyqtnatehdhnmtyiqalrhfstfanglhls
    kqpinlanllalsspiyrlelamigrlfaqdaelyadiimnlavietlkqtydealtffe
    nndrqgfidafhkvrdwfgdyseqflkesrqllqqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pv7B (B:)
    gmresyanenqfgfktinsdihkivivggygklgglfarylrasgypisildredwavae
    silanadvvivsvpinltletierlkpyltenmlladltsvkreplakmlevhtgavlgl
    hpmfgadiasmakqvvvrcdgrfperyewlleqiqiwgakiyqtnatehdhnmtyiqalr
    hfstfanglhlskqpinlanllalsspiyrlelamigrlfaqdaelyadiimdksenlav
    ietlkqtydealtffenndrqgfidafhkvrdwfgdyseqflkesrqllqqandlkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pv7B (B:)
    gfktinsdihkivivggygklgglfarylrasgypisildredwavaesilanadvvivs
    vpinltletierlkpyltenmlladltsvkreplakmlevhtgavlglhpmfgadiasma
    kqvvvrcdgrfperyewlleqiqiwgakiyqtnatehdhnmtyiqalrhfstfanglhls
    kqpinlanllalsspiyrlelamigrlfaqdaelyadiimdksenlavietlkqtydeal
    tffenndrqgfidafhkvrdwfgdyseqflkesrqllqqa