PDB entry 2pv4

View 2pv4 on RCSB PDB site
Description: crystal structure of an uncharacterized protein from duf3069 family (sama_2622) from shewanella amazonensis sb2b at 1.95 a resolution
Class: unknown function
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, unknown function
Deposited on 2007-05-09, released 2007-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Shewanella amazonensis [TaxId:326297]
    Gene: YP_928494.1, Sama_2622
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1S8W8 (1-144)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (134)
      • modified residue (138)
      • modified residue (142)
    Domains in SCOPe 2.08: d2pv4a1, d2pv4a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pv4A (A:)
    gmseidanyralaqqvadkvagrvialdrlpeslltayrslcdelladrdgrftrawdql
    pdsasslfercvfhgfylanawiqlsivardiselqdtdeaiaeqeysglyvrvaeaalk
    esvkklkkartdrsmynsmrevmgi