PDB entry 2pv3

View 2pv3 on RCSB PDB site
Description: Crystallographic Structure of SurA fragment lacking the second peptidyl-prolyl isomerase domain complexed with peptide NFTLKFWDIFRK
Class: Isomerase
Keywords: Survival protein A, Peptidyl-prolyl cis-trans isomerase domain, Peptide
Deposited on 2007-05-09, released 2007-10-02
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-30, with a file datestamp of 2007-10-26.
Experiment type: XRAY
Resolution: 3.39 Å
R-factor: 0.284
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone surA
    Species: Escherichia coli
    Gene: sura
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pv3a1, d2pv3a2
  • Chain 'B':
    Compound: Chaperone surA
    Species: Escherichia coli
    Gene: sura
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pv3b1, d2pv3b2
  • Chain 'C':
    Compound: C-peptide

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pv3A (A:)
    apqvvdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqii
    lqmgqkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiise
    vrnnevrrritilpqeveslaqqvgnqndastelnlshiliplpenptsdqvneaesqar
    aivdqarngadfgklaiahsadqqalnggqmgwgriqelpgifaqalstakkgdivgpir
    sgvgfhilkvndlrgesknisaaqkdrayrmlmnrkfseeaaswmqeqrasayvkilsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pv3A (A:)
    vdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqiilqmg
    qkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiisevrnn
    evrrritilpqeveslaqqvgnqndastelnlshiliplpenptsdqvneaesqaraivd
    qarndfgklaiahsadqqalnggqmgwgriqelpgifaqalstakkgdivgpirsgvgfh
    ilkvndlaaqkdrayrmlmnrkfseeaaswmqeqrasayvkils
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pv3B (B:)
    apqvvdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqii
    lqmgqkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiise
    vrnnevrrritilpqeveslaqqvgnqndastelnlshiliplpenptsdqvneaesqar
    aivdqarngadfgklaiahsadqqalnggqmgwgriqelpgifaqalstakkgdivgpir
    sgvgfhilkvndlrgesknisaaqkdrayrmlmnrkfseeaaswmqeqrasayvkilsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pv3B (B:)
    vdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqiilqmg
    qkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiisevrnn
    evrrritilpqeveslaqqvgnqndastelnlshiliplpenptsdqvneaesqaraivd
    qarndfgklaiahsadqqalnggqmgwgriqelpgifaqalstakkgdivgpirsgvgfh
    ilkvndlaaqkdrayrmlmnrkfseeaaswmqeqrasayvkils
    

  • Chain 'C':
    No sequence available.