PDB entry 2puz

View 2puz on RCSB PDB site
Description: Crystal structure of Imidazolonepropionase from Agrobacterium tumefaciens with bound product N-formimino-L-Glutamate
Class: hydrolase
Keywords: NYSGXRC, 9252b, PSI-2, Imidazolonepropionase, N-formimino-L-Glutamate, Product-bound, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, HYDROLASE
Deposited on 2007-05-09, released 2007-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazolonepropionase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: hutI, Atu3934, AGR_L_1824
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2puza1, d2puza2
  • Chain 'B':
    Compound: Imidazolonepropionase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: hutI, Atu3934, AGR_L_1824
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2puzb1, d2puzb2
  • Heterogens: FE, MG, CL, NIG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2puzA (A:)
    mpgnnsakgtatgnatalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpd
    dlstadettdcggrwitpalidchthlvfggnramefemrlngatyeeiakagggivssv
    rdtralsdevlvaqalprldtllsegvstieiksgygldietelkmlrvarrletlrpvr
    ivtsylaahatpadykgrnadyitdvvlpglekahaegladavdgfcegiafsvkeidrv
    faaaqqrglpvklhaeqlsnlggaelaasynalsadhleyldetgakalakagtvavllp
    gafyalrekqlppvqalrdagaeialatdcnpgtspltsllltmnmgatlfrmtveeclt
    attrnaakalgllaetgtleagksadfaiwdierpaelvyrigfnplharifkgqkvsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2puzA (A:)
    atalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadettdcggr
    witpalidchthlvfggnramefemrlngatyeeiakagggivssvrdtralsdevlvaq
    alprldtllsegvstieiksgygldietelkmlrvarrletlrpvrivtsylaahatpad
    ykgrnadyitdvvlpglekahaegladavdgfcegiafsvkeidrvfaaaqqrglpvklh
    aeqlsnlggaelaasynalsadhleyldetgakalakagtvavllpgafyalrekqlppv
    qalrdagaeialatdcnpgtspltsllltmnmgatlfrmtveecltattrnaakalglla
    etgtleagksadfaiwdierpaelvyrigfnplharifkgqkvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2puzB (B:)
    mpgnnsakgtatgnatalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpd
    dlstadettdcggrwitpalidchthlvfggnramefemrlngatyeeiakagggivssv
    rdtralsdevlvaqalprldtllsegvstieiksgygldietelkmlrvarrletlrpvr
    ivtsylaahatpadykgrnadyitdvvlpglekahaegladavdgfcegiafsvkeidrv
    faaaqqrglpvklhaeqlsnlggaelaasynalsadhleyldetgakalakagtvavllp
    gafyalrekqlppvqalrdagaeialatdcnpgtspltsllltmnmgatlfrmtveeclt
    attrnaakalgllaetgtleagksadfaiwdierpaelvyrigfnplharifkgqkvsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2puzB (B:)
    atalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadettdcggr
    witpalidchthlvfggnramefemrlngatyeeiakagggivssvrdtralsdevlvaq
    alprldtllsegvstieiksgygldietelkmlrvarrletlrpvrivtsylaahatpad
    ykgrnadyitdvvlpglekahaegladavdgfcegiafsvkeidrvfaaaqqrglpvklh
    aeqlsnlggaelaasynalsadhleyldetgakalakagtvavllpgafyalrekqlppv
    qalrdagaeialatdcnpgtspltsllltmnmgatlfrmtveecltattrnaakalglla
    etgtleagksadfaiwdierpaelvyrigfnplharifkgqkvs